PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB07G27140.1
Common NameLOC102706023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28200.8 Da    PI: 9.8913
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB07G27140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.11.6e-301059251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  rienk+nrqvtfskRrng+lKKA E+SvLCda+va+i+fs++gklye+ss
  OB07G27140.1 10 RIENKINRQVTFSKRRNGLLKKAREISVLCDADVALIVFSTKGKLYEFSS 59
                  8***********************************************96 PP

2K-box92.95.3e-31841711097
         K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                   +++++e++  e+  Lk++++ Lq++qR+llGe+L++L+ keLqqLe+qLe+slk+iRskKn+ll+e+i+elqkkek+l+++n  L+k 
  OB07G27140.1  84 NTEDQENWGDEYGILKSKLDALQKSQRQLLGEQLDTLTTKELQQLEHQLEHSLKHIRSKKNQLLFESISELQKKEKSLKNQNSVLQKL 171
                   56789******************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.861161IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.42E-33290IPR002100Transcription factor, MADS-box
CDDcd002658.90E-42274No hitNo description
PRINTSPR004045.7E-30323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-303859IPR002100Transcription factor, MADS-box
PfamPF014868.8E-2885171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.85488178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010154Biological Processfruit development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRGPVQLRR IENKINRQVT FSKRRNGLLK KAREISVLCD ADVALIVFST KGKLYEFSSH  60
SSMEGILERY QRYSFDEKAA LDPNTEDQEN WGDEYGILKS KLDALQKSQR QLLGEQLDTL  120
TTKELQQLEH QLEHSLKHIR SKKNQLLFES ISELQKKEKS LKNQNSVLQK LMETEKKKIN  180
VAANTHREEQ NITTASTSSP TPVAAPESTP TINAGQNQPR GSGESEAQPS PAQASSSKLP  240
PWMLRTVSNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-19174173Myocyte-specific enhancer factor 2B
1tqe_Q2e-19174173Myocyte-specific enhancer factor 2B
1tqe_R2e-19174173Myocyte-specific enhancer factor 2B
1tqe_S2e-19174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0914580.0AF091458.1 Oryza sativa MADS box transcription factor MADS18 (MADS18) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657934.10.0PREDICTED: MADS-box transcription factor 18
SwissprotA2YNI21e-162MAD18_ORYSI; MADS-box transcription factor 18
SwissprotQ0D4T41e-162MAD18_ORYSJ; MADS-box transcription factor 18
TrEMBLJ3MMT20.0J3MMT2_ORYBR; Uncharacterized protein
STRINGOB07G27140.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-61MIKC_MADS family protein